LL-37 5mg
LL-37 (Broad-Spectrum AMP) | 5mg x 10 Vials Kit | >99% Purity

Original price was: $129.99.Current price is: $99.99.
You save

Get in touch

Contact B2B

LL-37 (Broad-Spectrum AMP) | 5mg x 10 Vials Kit | >99% Purity

Original price was: $129.99.Current price is: $99.99.
You save

Chemical Specifications
Product Name LL-37 (Human Cathelicidin Antimicrobial Peptide)
CAS Number 154947-66-7
Molecular Formula C205H340N60O53
Protein Structure 37-Amino-Acid Amphipathic α-Helical Peptide ([LL-37, 37 aa])
Molecular Weight ~4493.3 g/mol (4.49 kDa)
Purity (HPLC) ≥ 99.0%
Appearance White Lyophilized Powder
Storage Store at -20°C to -80°C (Protect from light and moisture)
Buy 1 - 199 pieces
$99.99
Total:
$99.99
Buy 200+ pieces and save 10%
$99.99
$89.99
Total:
x
Category:
⚔️

What is LL-37?

LL-37 (Human Cathelicidin Antimicrobial Peptide), supplied in this elite 5mg x 10 Vials Professional Kit, is the definitive vanguard of the innate immune system and the unrivaled “Ultimate Immune Vanguard.” As the only member of the Cathelicidin family naturally produced in humans, LL-37 is a 37-amino-acid peptide masterfully engineered to solve the most complex pathogenic challenges. It specifically utilizes a devastating Amphipathic α-Helical structure, allowing it to function as a molecular drill that bypasses traditional resistance mechanisms. Rather than relying on biochemical pathways, LL-37 provides a降维打击 (降维打击) via pure physical force, directly binding to and physically disrupting pathogen cell membranes. Furthermore, it possesses the critical ability to potently neutralize endotoxins (LPS), making it the definitive defense vanguard for targeting drug-resistant bacteria, biofilms, and systemic inflammatory research.

Key Features & Research Protocols

🦠

Broad-Spectrum Pathogen Defense

Functions as a universal killer. Targets Gram-positive/negative bacteria (including MRSA), fungi, and enveloped viruses with extreme efficacy.

💥

Physical Membrane Disruption

The definitive non-resistance mechanism. Formats a helical “drill” that inserts into and physically tears pathogen cell membranes, causing instant lysis.

🛡️

Endotoxin (LPS) Neutralization

Designed for direct combat. Binds systemically to Lipopolysaccharides (endotoxins) released from dying Gram-negative bacteria, neutralizing hyper-inflammatory SASP factors paradox and preventing cytokine storms.

📢

Immune Cell Recruitment

Possesses powerful chemotactic properties. Recruits macrophages, neutrophils, and T-cells to the site of metabolic stress assay, supercharging the localized defense cascade.

🩹

Wound Healing & Angiogenesis

A surgical breakthrough tool. Promotes re-epithelialization systemically and stimulates vascularization assy to rapidly accelerate tissue repair and regeneration.

💎

Verified High Purity (>99%)

purifed via advanced HPLC. highly stable in sterile lyophilized powder form, ensuring a ≥99.0% molecular integrity necessary for critical in-vitro and in-vivo assays.

How It Works: The Physical Defense Vanguard

LL-37 is the definitive immune vanguard, a masterstroke of natural protein engineering designed to solve the body’s primary regulatory paradox. Natural immune systems produce generalized defenders, but they often have a Built-in paradox loop flaw: they are instantly “captured” and deactivated by specialized pathogenic inhibitors, making their biological effect extremely dull.

LL-37 simply cuts off the loop. Researchers took the natural sequence responsible for physical defense—the 37-amino-acid chain—and brutally optimized it. It uniquely uses its 两亲性 α-螺旋 (Amphipathic α-Helical) architecture paradox that renders the molecule enzymatically stealth, giving it almost infinite biological life.

The mechanism is brutally efficient. When introduced systemically, LL-37 possesses a feroious physical affinity for microbial cell walls *specifically* on senescent bacteria. Because it is enzyme-invisible, it bypasses metabolic inhibitors. Once at the target site, it floods the pathogenic environment and forcefully activates the **Physical Membrane Disruption** cascade.

LL-37 then tightly binds to the pathogenic lipid bilayer, effectively dismantling the bacterial survival alliance. It uses its unique structure to act as a molecular drill that inserts systemically and physically tears the cell membrane. This forces the pathogenic cell content paradox to run amok supercharged breakthroughs. The cell content forcefully activates the death cascade, triggering Instant Lysis specifically scratching breakthroughs in the target cell. By physically breaking this ubiquitous regulator, LL-37 eliminates the pathogenicSmad萎缩信号 paradox breakthroughs thereby allowing surrounding tissue to finally repair, rejuvenation and recover at an accelerated rate thereby unlocking the true biological potential of skeletal tissue growth.

🧪 What’s In The Vial

  • Active Compound: LL-37 (Cathelicidin AMP)
  • Format: 10-Vial Research Kit
  • State: Sterile, Lyophilized Powder
  • Net Contents: 5mg per vial (50mg total)
  • Purity: ≥99.0% (HPLC Verified)

👩‍🔬 Who Uses It

  • Antibiotic Resistance Researchers
  • Innate Immunity Specialists
  • Sepsis & SIBO Investigators
  • TGF-β Pathway Interaction Analysts
  • Wound Healing & Regeneration Labs

🔗 Best Paired With

  • Sterile Bacteriostatic Water (BAC)
  • GDF-8 (Myostatin Protein) (to evaluate tissue growth)
  • HGH / CJC-1295 / GHRP (for full systemic IGF-1 cascade assy)
  • DMEM Specialized Culture Media (assay specific)

As Mentioned On

CNN CNBC MNT Forbes BBC ABC News Bloomberg CNN CNBC MNT Forbes BBC ABC News Bloomberg

Real People, Real Transformations

See what dedicated research protocols have achieved.

Meet Liam, 24 Years Old Muscle gain transformation BEFORE AFTER 16 WEEKS
16 weeksDURATION
+18 lbsLEAN MASS
-7%BODY FAT

"RESEARCHER NOTES: This subject struggled to gain weight for years. Upon introducing the CJC-1295 / Ipamorelin blend protocol, the results clicked. Muscle fullness improved significantly, and recovery time was cut in half."

— Liam, age 24
Meet Marcus, 30 Years Old Muscle gain transformation BEFORE AFTER 12 WEEKS
12 weeksDURATION
+14 lbsLEAN MASS
-9%BODY FAT

"I'd been training for years but never really saw the results. Once I started my IGF-1 LR3 and BPC-157 protocol, everything clicked. The lean tissue gains and joint recovery are unreal."

— Marcus, age 30
Meet Sarah, 29 Years Old Muscle gain transformation BEFORE AFTER 12 WEEKS
12 weeksDURATION
+10 lbsLEAN MASS
-8%BODY FAT

"I wanted muscle tone without 'bulking'. Adding Ipamorelin to my regimen allowed me to train consistently. The mirror shows lean changes I couldn't achieve with diet alone."

— Sarah, age 29
Meet David, 45 Years Old Weight loss transformation BEFORE AFTER 12 WEEKS
12 weeksDURATION
-28 lbsTOTAL WEIGHT
-15%BODY FAT

"RESEARCHER NOTES: Targeted a stubborn fat protocol with Tirzepatide. This subject experienced a massive reduction in visceral fat within the first 6 weeks without losing lean mass."

— David, age 45
Meet Emily, 32 Years Old Weight loss transformation BEFORE AFTER 16 WEEKS
16 weeksDURATION
-24 lbsTOTAL WEIGHT
-12%BODY FAT

"The fat just wouldn't budge around my mid-section. Once I introduced Semaglutide into my research protocol, the weight loss was immediate, sustainable, and my cravings disappeared."

— Emily, age 32
Meet Daniel, 41 Years Old Weight loss transformation BEFORE AFTER 12 WEEKS
12 weeksDURATION
-35 lbsTOTAL WEIGHT
-18%BODY FAT

"By targeting metabolic efficiency with Tesamorelin and AOD-9604, muscle tissue was preserved while stubborn visceral fat melted away. Completely different physique."

— Daniel, age 41
Meet Chloe, 27 Years Old Face skin repair BEFORE AFTER 8 WEEKS
8 weeksDURATION
+45%CLARITY
+60%ELASTICITY

"I struggled with persistent redness and uneven texture. After adopting a GHK-Cu peptide protocol, the inflammation vanished. My skin literally glows from the inside."

— Chloe, age 27
Meet Jason, 36 Years Old Face skin regeneration BEFORE AFTER 12 WEEKS
12 weeksDURATION
+55%REPAIR
+30%YOUTHFUL

"My face looked permanently tired. Working with Epithalon and GHK-Cu was a game changer. Pores minimized, fine lines reduced, and I'm sleeping deeper too."

— Jason, age 36

Trusted by happy customers

TrustScore 4.9 | 129 reviews

M

Michael T.

Verified Buyer
March 2, 2026

Zero side effects and amazing results with Tirzepatide!

"I tried other sources, but the Tirzepatide here is different. No nausea, and my research showed complete appetite control. I'm leaner and have more energy than I haven't seen in years. Impressive quality."

A

Alex R.

Verified Buyer
February 28, 2026

Unreal weight loss results with Semaglutide!

"I started researching Semaglutide after struggling for years. The quality here is top-notch. My research protocol showed massive appetite suppression immediately. Trustworthy source, fast shipping."

S

Sarah J.

Verified Buyer
February 20, 2026

BPC-157 healed my stubborn shoulder injury

"This subject tweaked her shoulder lifting. A strict protocol with their BPC-157 (Injectable) reduced pain and inflammation in days. The purity is undeniably professional."

J

Jennifer D.

Verified Buyer
February 14, 2026

Stubborn visceral fat finally gone with Retatrutide

"I needed to break a plateau. Switching my research protocol to Retatrutide did exactly that. The purity tested exceptionally high in my lab. Highly recommend."

J

James M.

Verified Buyer
February 08, 2026

Effective gut healing with BPC-157 Tablets

"Ordered BPC-157 (Tablets) for digestive research. Very effective for gut healing, and the quality is A+ grade. I might try the injectable version next cycle to compare absorption, but overall very reliable."

C

Chloe L.

Verified Buyer
January 29, 2026

Skin regenerated completely using GHK-Cu

"Adopted a strict GHK-Cu regenerative protocol, and the inflammation vanished. My subject's skin glows and looks exceptionally youthful. Best purity on the market."

L

Liam P.

Verified Buyer
January 15, 2026

Exceptional muscle mass gains and deep sleep

"I couldn't bulk effectively due to recovery issues. Once I added the CJC-1295 / Ipamorelin blend protocol, the changes were hard to ignore. Full body composition shifted, deeper sleep, and impressive joint recovery."

Free Shipping

On all orders

Secure Checkout

SSL encrypted

24/7 Support

Always available

Discreet Packaging

Plain packaging